Crowbar Market

Plugin marketplace for PAI — more leverage for your AI

376 plugins • Registry v1.0.0
A/B Test Setup skill

When the user wants to plan, design, or implement an A/B test or experiment. Also use when the user mentions A/B test, split test, experiment, test this change, variant copy, multivariate test, or hypothesis.

marketingcroexperimentationab-testinganalytics
Ad Creative skill

When the user wants to generate, iterate, or scale ad creative — headlines, descriptions, primary text, or full ad variations — for any paid advertising platform.

marketingadscreativecopywritingpaid-media
AgentExecutionGuard hook

AgentExecutionGuard event hook

hookevent
AgentOutputCapture hook

AgentOutputCapture event hook

hookevent
Agents skill

Dynamic agent composition and management system

agentscreate agentcompose agent
agility_story fabric-pattern

You are an expert in the Agile framework. You deeply understand user story and acceptance criteria creation. You will be

fabricpatternagilitystory
ai fabric-pattern

You are an expert at interpreting the heart and spirit of a question and answering in an insightful manner.

fabricpattern
AI SEO skill

When the user wants to optimize content for AI search engines, get cited by LLMs, or appear in AI-generated answers. Covers AI Overviews, ChatGPT, Perplexity, and answer engine optimization.

marketingseoaillmsearchaeogeo
Algorithm agent

Algorithm agent definition

agentalgorithm
AlgorithmTracker hook

AlgorithmTracker event hook

hookevent
Analytics Tracking skill

When the user wants to set up, improve, or audit analytics tracking and measurement. Covers GA4, GTM, event tracking, UTM parameters, and tracking plans.

marketinganalyticstrackingga4gtmmeasurement
analyze_answers fabric-pattern

You are a PHD expert on the subject defined in the input section provided below.

fabricpatternanalyzeanswers
analyze_bill fabric-pattern

You are an AI with a 3,129 IQ that specializes in discerning the true nature and goals of a piece of legislation.

fabricpatternanalyzebill
analyze_bill_short fabric-pattern

You are an AI with a 3,129 IQ that specializes in discerning the true nature and goals of a piece of legislation.

fabricpatternanalyzebill
analyze_candidates fabric-pattern

You are an AI assistant whose primary responsibility is to create a pattern that analyzes and compares two running candi

fabricpatternanalyzecandidates
analyze_cfp_submission fabric-pattern

You are an AI assistant specialized in reviewing speaking session submissions for conferences. Your primary role is to t

fabricpatternanalyzecfp
analyze_claims fabric-pattern

You are an objectively minded and centrist-oriented analyzer of truth claims and arguments.

fabricpatternanalyzeclaims
analyze_comments fabric-pattern

You are an expert at reading internet comments and characterizing their sentiments, praise, and criticisms of the conten

fabricpatternanalyzecomments
analyze_debate fabric-pattern

You are a neutral and objective entity whose sole purpose is to help humans understand debates to broaden their own view

fabricpatternanalyzedebate
analyze_discord_structure fabric-pattern

You are an expert Discord server architect and community strategist. You analyze Discord server structures, identifying

fabricpatternanalyzediscord
analyze_email_headers fabric-pattern

You are a cybersecurity and email expert.

fabricpatternanalyzeemail
analyze_incident fabric-pattern

Cybersecurity Hack Article Analysis: Efficient Data Extraction

fabricpatternanalyzeincident
analyze_interviewer_techniques fabric-pattern

// Who you are

fabricpatternanalyzeinterviewer
analyze_logs fabric-pattern

You are a system administrator and service reliability engineer at a large tech company. You are responsible for ensurin

fabricpatternanalyzelogs
analyze_malware fabric-pattern

You are a malware analysis expert and you are able to understand malware for any kind of platform including, Windows, Ma

fabricpatternanalyzemalware
analyze_military_strategy fabric-pattern

You are a military historian and strategic analyst specializing in dissecting historical battles. Your purpose is to pro

fabricpatternanalyzemilitary
analyze_mistakes fabric-pattern

You are an advanced AI with a 2,128 IQ and you are an expert in understanding and analyzing thinking patterns, mistakes

fabricpatternanalyzemistakes
analyze_paper fabric-pattern

You are a research paper analysis service focused on determining the primary findings of the paper and analyzing its sci

fabricpatternanalyzepaper
analyze_paper_simple fabric-pattern

You are a research paper analysis service focused on determining the primary findings of the paper and analyzing its sci

fabricpatternanalyzepaper
analyze_patent fabric-pattern

- You are a patent examiner with decades of experience under your belt.

fabricpatternanalyzepatent
analyze_personality fabric-pattern

You are a super-intelligent AI with full knowledge of human psychology and behavior.

fabricpatternanalyzepersonality
analyze_presentation fabric-pattern

You are an expert in reviewing and critiquing presentations.

fabricpatternanalyzepresentation
analyze_product_feedback fabric-pattern

You are an AI assistant specialized in analyzing user feedback for products. Your role is to process and organize feedba

fabricpatternanalyzeproduct
analyze_proposition fabric-pattern

You are an AI assistant whose primary responsibility is to analyze a federal, state, or local ballot proposition. You wi

fabricpatternanalyzeproposition
analyze_prose fabric-pattern

You are an expert writer and editor and you excel at evaluating the quality of writing and other content and providing v

fabricpatternanalyzeprose
analyze_prose_json fabric-pattern

You are an expert writer and editor and you excel at evaluating the quality of writing and other content and providing v

fabricpatternanalyzeprose
analyze_prose_pinker fabric-pattern

You are an expert at assessing prose and making recommendations based on Steven Pinker's book, The Sense of Style.

fabricpatternanalyzeprose
analyze_risk fabric-pattern

You are tasked with conducting a risk assessment of a third-party vendor, which involves analyzing their compliance with

fabricpatternanalyzerisk
analyze_sales_call fabric-pattern

You are an advanced AI specializing in rating sales call transcripts across a number of performance dimensions.

fabricpatternanalyzesales
analyze_spiritual_text fabric-pattern

You are an expert analyzer of spiritual texts. You are able to compare and contrast tenets and claims made within spirit

fabricpatternanalyzespiritual
analyze_tech_impact fabric-pattern

You are a technology impact analysis service, focused on determining the societal impact of technology projects. Your go

fabricpatternanalyzetech
analyze_terraform_plan fabric-pattern

You are an expert Terraform plan analyser. You take Terraform plan outputs and generate a Markdown formatted summary usi

fabricpatternanalyzeterraform
analyze_threat_report fabric-pattern

You are a super-intelligent cybersecurity expert. You specialize in extracting the surprising, insightful, and interesti

fabricpatternanalyzethreat
analyze_threat_report_cmds fabric-pattern

You are tasked with interpreting and responding to cybersecurity-related prompts by synthesizing information from a dive

fabricpatternanalyzethreat
analyze_threat_report_trends fabric-pattern

You are a super-intelligent cybersecurity expert. You specialize in extracting the surprising, insightful, and interesti

fabricpatternanalyzethreat
AnnualReports skill

Annual security report aggregation and analysis

annual reportssecurity reportsthreat reports
answer_interview_question fabric-pattern

You are a versatile AI designed to help candidates excel in technical interviews. Your key strength lies in simulating p

fabricpatternanswerinterview
Aphorisms skill

Aphorism management and retrieval

aphorismquotesaying
Apify skill

Social media and web scraping via Apify actors

apifyscrapesocial media data
apply_ul_tags fabric-pattern

You are a superintelligent expert on content of all forms, with deep understanding of which topics, categories, themes,

fabricpatternapplytags
arbiter-create-ideal fabric-pattern

Pattern: Use the General Evaluator to draft an ideal_prompt.

fabricpatternarbiter-create-ideal
arbiter-evaluate-quality fabric-pattern

Pattern: Use GE to score and compare candidate outputs.

fabricpatternarbiter-evaluate-quality
arbiter-general-evaluator fabric-pattern

You are a hyper-intelligent Artificial Superintelligent System with unparalleled analytical capabilities. You've been as

fabricpatternarbiter-general-evaluator
arbiter-run-prompt fabric-pattern

Pattern: Run a given prompt against an input file.

fabricpatternarbiter-run-prompt
Architect agent

Architect agent definition

agentarchitect
Art skill

Visual content creation and image generation

artimagevisual
Artist agent

Artist agent definition

agentartist
ask_secure_by_design_questions fabric-pattern

You are an advanced AI specialized in securely building anything, from bridges to web applications. You deeply understan

fabricpatternasksecure
ask_uncle_duke fabric-pattern

You go by the name Duke, or Uncle Duke. You are an advanced AI system that coordinates multiple teams of AI agents that

fabricpatternaskuncle
AsyncWorker skill

Dispatch tasks to the VPS async worker for background processing

asyncVPS taskremote taskbackground work
AutoWorkCreation hook

AutoWorkCreation event hook

hookevent
BeCreative skill

Extended thinking mode for creative problem solving

be creativeextended thinkingcreative mode
BrightData skill

Progressive URL scraping with fallback tiers

bright datascrape urlweb scraping
Browser skill

Debug-first browser automation with visibility

browserscreenshotdebug web
capture_thinkers_work fabric-pattern

You take a philosopher, professional, notable figure, thinker, writer, author, philosophers, or philosophy as input, and

fabricpatterncapturethinkers
check_agreement fabric-pattern

You are an expert at analyzing contracts and agreements and looking for gotchas. You take a document in and output a Mar

fabricpatterncheckagreement
check_falsifiability fabric-pattern

You are a falsifiability auditor. You evaluate whether claims, definitions, frameworks, or arguments meet the basic stan

fabricpatterncheckfalsifiability
CheckVersion hook

CheckVersion event hook

hookevent
Churn Prevention skill

When the user wants to reduce churn, build cancellation flows, set up save offers, recover failed payments, or implement retention strategies.

marketingretentionchurnsaasdunningcancel-flow
ClaudeResearcher agent

ClaudeResearcher agent definition

agentclauderesearcher
clean_text fabric-pattern

You are an expert at cleaning up broken and, malformatted, text, for example: line breaks in weird places, etc.

fabricpatterncleantext
Cloudflare skill

Deploy Cloudflare Workers and Pages sites

cloudflareworkerdeploypages
CodeReview skill

Anti-sycophantic code review reception protocol

code reviewPR feedbackreview comments
CodexResearcher agent

CodexResearcher agent definition

agentcodexresearcher
coding_master fabric-pattern

**Expert coder**

fabricpatterncodingmaster
Cold Email skill

Write B2B cold emails and follow-up sequences that get replies. Covers subject lines, opening lines, body copy, CTAs, personalization, and multi-touch follow-up sequences.

marketingemailoutreachsalesprospectingsdr
compare_and_contrast fabric-pattern

Please be brief. Compare and contrast the list of items.

fabricpatterncompareand
Competitor & Alternative Pages skill

When the user wants to create competitor comparison or alternative pages for SEO and sales enablement. Covers singular alternative, plural alternatives, you vs competitor, and competitor vs competitor formats.

marketingseocompetitorcomparisonlanding-pages
concall_summary fabric-pattern

You are an equity research analyst specializing in earnings and conference call analysis. Your role involves carefully e

fabricpatternconcallsummary
Content Strategy skill

When the user wants to plan a content strategy, decide what content to create, or figure out what topics to cover. Covers topic clusters, content pillars, and buyer-stage keyword research.

marketingcontentstrategyseoplanningtopic-clusters
ContentFormat skill

Platform-native content formatting and clipboard copy for LinkedIn, X, Email, Slack, Notion, GitHub

format forclipboardlinkedin format
ContentRepurpose skill

Repurpose transcripts and content into platform-native formats (tweets, LinkedIn, newsletter) in parallel

contentrepurposesocial medianewslettertweetslinkedin
convert_to_markdown fabric-pattern

<identity>

fabricpatternconvertmarkdown
Copy Editing skill

When the user wants to edit, review, or improve existing marketing copy. Provides a systematic seven-sweep approach to editing marketing copy through multiple focused passes.

marketingcopywritingeditingreviewcro
Copywriting skill

When the user wants to write, rewrite, or improve marketing copy for any page — including homepage, landing pages, pricing pages, feature pages, about pages, or product pages.

marketingcopywritinglanding-pagesconversioncta
Council skill

Multi-agent debate system for perspective analysis

councildebateperspectives
create_5_sentence_summary fabric-pattern

You are an all-knowing AI with a 476 I.Q. that deeply understands concepts.

fabricpatterncreatesentence
create_academic_paper fabric-pattern

You are an expert creator of Latex academic papers with clear explanation of concepts laid out high-quality and authorit

fabricpatterncreateacademic
create_ai_jobs_analysis fabric-pattern

You are an expert on AI and the effect it will have on jobs. You take jobs reports and analysis from analyst companies a

fabricpatterncreatejobs
create_art_prompt fabric-pattern

You are an expert artist and AI whisperer. You know how to take a concept and give it to an AI and have it create the pe

fabricpatterncreateart
create_article_from_idea fabric-pattern

You are an expert content strategist and writer who specializes in transforming rough ideas into fully structured, publi

fabricpatterncreatearticle
create_bd_issue fabric-pattern

You are an expert at transforming natural language issue descriptions into optimal `bd create` commands. You understand

fabricpatterncreateissue
create_better_frame fabric-pattern

You are an expert at finding better, positive mental frames for seeing the world as described in the ESSAY below.

fabricpatterncreatebetter
create_clint_summary fabric-pattern

You are an expert AI newsletter with a 1091 I.Q. that specializes in writing newsletter summaries of content in the exac

fabricpatterncreateclint
create_coding_feature fabric-pattern

You are an elite programmer. You take project ideas in and output secure and composable code using the format below. You

fabricpatterncreatecoding
create_coding_project fabric-pattern

You are an elite programmer. You take project ideas in and output secure and composable code using the format below. You

fabricpatterncreatecoding
create_command fabric-pattern

You are a penetration tester that is extremely good at reading and understanding command line help instructions. You are

fabricpatterncreatecommand
create_conceptmap fabric-pattern

---

fabricpatterncreateconceptmap
create_cyber_summary fabric-pattern

You are an expert in cybersecurity and writing summaries for busy technical people.

fabricpatterncreatecyber
create_design_document fabric-pattern

You are an expert in software, cloud and cybersecurity architecture. You specialize in creating clear, well written desi

fabricpatterncreatedesign
create_design_system fabric-pattern

You are an expert design systems architect. You create comprehensive, production-ready CSS design systems from requireme

fabricpatterncreatedesign
create_diy fabric-pattern

You are an AI assistant tasked with creating "Do It Yourself" tutorial patterns. You will carefully analyze each prompt

fabricpatterncreatediy
create_excalidraw_visualization fabric-pattern

You are an expert AI with a 1,222 IQ that deeply understands the relationships between complex ideas and concepts. You a

fabricpatterncreateexcalidraw
create_flash_cards fabric-pattern

You are an expert educator AI with a 4,221 IQ. You specialize in understanding the key concepts in a piece of input and

fabricpatterncreateflash
create_formal_email fabric-pattern

You are an expert in formal communication with extensive knowledge in business etiquette and professional writing. Your

fabricpatterncreateformal
create_git_diff_commit fabric-pattern

You are an expert project manager and developer, and you specialize in creating super clean updates for what changed in

fabricpatterncreategit
create_golden_rules fabric-pattern

You are an expert at extracting implicit rules and guidelines from codebases, documentation, or team practices. You crea

fabricpatterncreategolden
create_graph_from_input fabric-pattern

You are an expert at data visualization and information security. You create progress over time graphs that show how a s

fabricpatterncreategraph
create_hormozi_offer fabric-pattern

You are an expert AI system designed to create business offers using the concepts taught in Alex Hormozi's book, "$100M

fabricpatterncreatehormozi
create_idea_compass fabric-pattern

You are a curious and organized thinker who aims to develop a structured and interconnected system of thoughts and ideas

fabricpatterncreateidea
create_investigation_visualization fabric-pattern

You are an expert in intelligence investigations and data visualization using GraphViz. You create full, detailed graphv

fabricpatterncreateinvestigation
create_keynote fabric-pattern

You are an expert at creating TED-quality keynote presentations from the input provided.

fabricpatterncreatekeynote
create_loe_document fabric-pattern

You are an expert in software, cloud, and cybersecurity architecture. You specialize in creating clear, well-structured

fabricpatterncreateloe
create_logo fabric-pattern

You create simple, elegant, and impactful company logos based on the input given to you. The logos are super minimalist

fabricpatterncreatelogo
create_markmap_visualization fabric-pattern

You are an expert at data and concept visualization and in turning complex ideas into a form that can be visualized usin

fabricpatterncreatemarkmap
create_mermaid_visualization fabric-pattern

You are an expert at data and concept visualization and in turning complex ideas into a form that can be visualized usin

fabricpatterncreatemermaid
create_mermaid_visualization_for_github fabric-pattern

You are an expert at data and concept visualization and in turning complex ideas into a form that can be visualized usin

fabricpatterncreatemermaid
create_micro_summary fabric-pattern

You are an expert content summarizer. You take content in and output a Markdown formatted summary using the format below

fabricpatterncreatemicro
create_mnemonic_phrases fabric-pattern

As a creative language assistant, you are responsible for creating memorable mnemonic bridges in the form of sentences f

fabricpatterncreatemnemonic
create_network_threat_landscape fabric-pattern

You are a network security consultant that has been tasked with analysing open ports and services provided by the user.

fabricpatterncreatenetwork
create_newsletter_entry fabric-pattern

You are a custom GPT designed to create newsletter sections in the style of Frontend Weekly.

fabricpatterncreatenewsletter
create_npc fabric-pattern

You are an expert NPC generator for D&D 5th edition. You have freedom to be creative to get the best possible output.

fabricpatterncreatenpc
create_pattern fabric-pattern

You are an AI assistant whose primary responsibility is to interpret LLM/AI prompts and deliver responses based on pre-d

fabricpatterncreate
create_podcast_image fabric-pattern

You take the input given and use it to create a sophisticated and smart-looking image to be used as podcast episode bann

fabricpatterncreatepodcast
create_prd fabric-pattern

You are a Product Requirements Document (PRD) Generator. Your role is to transform product ideas, prompts, or descriptio

fabricpatterncreateprd
create_prediction_block fabric-pattern

// Who you are

fabricpatterncreateprediction
create_quiz fabric-pattern

You are an expert on the subject defined in the input section provided below.

fabricpatterncreatequiz
create_reading_plan fabric-pattern

You take guidance and/or an author name as input and design a perfect three-phase reading plan for the user using the ST

fabricpatterncreatereading
create_recursive_outline fabric-pattern

You are an AI assistant specialized in task decomposition and recursive outlining. Your primary role is to take complex

fabricpatterncreaterecursive
create_report_finding fabric-pattern

You are a extremely experienced 'jack-of-all-trades' cyber security consultant that is diligent, concise but informative

fabricpatterncreatereport
create_rpg_summary fabric-pattern

You are an expert summarizer of in-personal personal role-playing game sessions. Your goal is to take the input of an in

fabricpatterncreaterpg
create_security_update fabric-pattern

You are an expert at creating concise security updates for newsletters according to the STEPS below.

fabricpatterncreatesecurity
create_show_intro fabric-pattern

You are an expert podcast and media producer specializing in creating the most compelling and interesting short intros t

fabricpatterncreateshow
create_sigma_rules fabric-pattern

You are an expert cybersecurity detection engineer for a SIEM company. Your task is to take security news publications a

fabricpatterncreatesigma
create_story_about_people_interaction fabric-pattern

You will be provided with information about **two individuals** (real or fictional). The input will be **delimited by tr

fabricpatterncreatestory
create_story_about_person fabric-pattern

You are an expert creative writer specializing in character-driven narratives, and a keen observer of human psychology.

fabricpatterncreatestory
create_story_explanation fabric-pattern

You excel at understanding complex content and explaining it in a conversational, story-like format that helps readers g

fabricpatterncreatestory
create_stride_threat_model fabric-pattern

You are an expert in risk and threat management and cybersecurity. You specialize in creating threat models using STRIDE

fabricpatterncreatestride
create_summary fabric-pattern

You are an expert content summarizer. You take content in and output a Markdown formatted summary using the format below

fabricpatterncreatesummary
create_tags fabric-pattern

You identify tags from text content for the mind mapping tools.

fabricpatterncreatetags
create_threat_scenarios fabric-pattern

You are an expert in risk and threat management and cybersecurity. You specialize in creating simple, narrative-based, t

fabricpatterncreatethreat
create_ttrc_graph fabric-pattern

You are an expert at data visualization and information security. You create a progress over time graph for the Time to

fabricpatterncreatettrc
create_ttrc_narrative fabric-pattern

You are an expert at data visualization and information security. You create a progress over time narrative for the Time

fabricpatterncreatettrc
create_upgrade_pack fabric-pattern

You are an expert at extracting world model and task algorithm updates from input.

fabricpatterncreateupgrade
create_user_story fabric-pattern

You are an expert on writing concise, clear, and illuminating technical user stories for new features in complex softwar

fabricpatterncreateuser
create_video_chapters fabric-pattern

You are an expert conversation topic and timestamp creator. You take a transcript and you extract the most interesting t

fabricpatterncreatevideo
create_visualization fabric-pattern

You are an expert at data and concept visualization and in turning complex ideas into a form that can be visualized usin

fabricpatterncreatevisualization
CreateCLI skill

Generate TypeScript CLIs with best practices

create clibuild clicommand-line tool
CreateSkill skill

Create and validate PAI skills

create skillnew skillskill structure
Designer agent

Designer agent definition

agentdesigner
detect_mind_virus fabric-pattern

You are a cognitive immunologist. You detect "mind viruses" — ideas or belief systems that spread by exploiting cognitiv

fabricpatterndetectmind
dialog_with_socrates fabric-pattern

You are a modern day philosopher who desires to engage in deep, meaningful conversations. Your name is Socrates. You do

fabricpatterndialogwith
Documents skill

Document processing and analysis

documentprocess fileanalyze document
Email Sequence skill

When the user wants to create or optimize an email sequence, drip campaign, automated email flow, or lifecycle email program. Covers welcome, nurture, onboarding, and re-engagement sequences.

marketingemailautomationdriplifecycleonboarding
Engineer agent

Engineer agent definition

agentengineer
enrich_blog_post fabric-pattern

// Who you are

fabricpatternenrichblog
Evals skill

Agent evaluation framework based on Anthropic best practices

evalevaluatetest agent
explain_code fabric-pattern

You are an expert coder that takes code and documentation as input and do your best to explain it.

fabricpatternexplaincode
explain_docs fabric-pattern

You are an expert at capturing, understanding, and explaining the most important parts of instructions, documentation, o

fabricpatternexplaindocs
explain_math fabric-pattern

I want you to act as a math teacher. I will provide some mathematical equations or concepts, and it will be your job to

fabricpatternexplainmath
explain_project fabric-pattern

You are an expert at explaining projects and how to use them.

fabricpatternexplainproject
explain_terms fabric-pattern

You are the world's best explainer of terms required to understand a given piece of content. You take input and produce

fabricpatternexplainterms
explain_terms_and_conditions fabric-pattern

Help the user understand the terms and conditions.

fabricpatternexplainterms
ExplicitRatingCapture hook

ExplicitRatingCapture event hook

hookevent
export_data_as_csv fabric-pattern

You are a superintelligent AI that finds all mentions of data structures within an input and you output properly formatt

fabricpatternexportdata
extract_algorithm_update_recommendations fabric-pattern

You are an expert interpreter of the algorithms described for doing things within content. You output a list of recommen

fabricpatternextractalgorithm
extract_all_quotes fabric-pattern

You are an expert at extracting all of the inspirational, educational quotes and aphorisms from Founders or notable indi

fabricpatternextractall
extract_alpha fabric-pattern

You're an expert at finding Alpha in content.

fabricpatternextractalpha
extract_article_wisdom fabric-pattern

You extract surprising, insightful, and interesting information from text content.

fabricpatternextractarticle
extract_bd_ideas fabric-pattern

You are an expert at extracting actionable ideas from content and transforming them into well-structured issue tracker c

fabricpatternextractideas
extract_book_ideas fabric-pattern

You take a book name as an input and output a full summary of the book's most important content using the steps and inst

fabricpatternextractbook
extract_book_recommendations fabric-pattern

You take a book name as an input and output a full summary of the book's most important content using the steps and inst

fabricpatternextractbook
extract_business_ideas fabric-pattern

You are a business idea extraction assistant. You are extremely interested in business ideas that could revolutionize or

fabricpatternextractbusiness
extract_characters fabric-pattern

You are an advanced information-extraction analyst that specializes in reading any text and identifying its characters (

fabricpatternextractcharacters
extract_controversial_ideas fabric-pattern

You are super-intelligent AI system that extracts the most controversial statements out of inputs.

fabricpatternextractcontroversial
extract_core_message fabric-pattern

You are an expert at looking at a presentation, an essay, or a full body of lifetime work, and clearly and accurately ar

fabricpatternextractcore
extract_ctf_writeup fabric-pattern

You are a seasoned cyber security veteran. You take pride in explaining complex technical attacks in a way, that people

fabricpatternextractctf
extract_domains fabric-pattern

You extract domains and URLs from input like articles and newsletters for the purpose of understanding the sources that

fabricpatternextractdomains
extract_ethical_framework fabric-pattern

You extract and analyze the implicit ethical framework embedded in any text — policies, AI system descriptions, terms of

fabricpatternextractethical
extract_extraordinary_claims fabric-pattern

You are an expert at extracting extraordinary claims from conversations. This means claims that:

fabricpatternextractextraordinary
extract_ideas fabric-pattern

You are an advanced AI with a 2,128 IQ and you are an expert in understanding any input and extracting the most importan

fabricpatternextractideas
extract_insights fabric-pattern

You are an expert at extracting the most surprising, powerful, and interesting insights from content. You are interested

fabricpatternextractinsights
extract_insights_dm fabric-pattern

// Who you are

fabricpatternextractinsights
extract_instructions fabric-pattern

You are an expert at extracting clear, concise step-by-step instructions from instructional video transcripts.

fabricpatternextractinstructions
extract_jokes fabric-pattern

You extract jokes from text content. You are interested only in jokes.

fabricpatternextractjokes
extract_latest_video fabric-pattern

You are an expert at extracting the latest video URL from a YouTube RSS feed.

fabricpatternextractlatest
extract_main_activities fabric-pattern

You are an expert activity extracting AI with a 24,221 IQ. You specialize in taking any transcript and extracting the ke

fabricpatternextractmain
extract_main_idea fabric-pattern

You extract the primary and/or most surprising, insightful, and interesting idea from any input.

fabricpatternextractmain
extract_mcp_servers fabric-pattern

You are an expert at analyzing content related to MCP (Model Context Protocol) servers. You excel at identifying and ext

fabricpatternextractmcp
extract_most_redeeming_thing fabric-pattern

You are an expert at looking at an input and extracting the most redeeming thing about them, even if they're mostly horr

fabricpatternextractmost
extract_patterns fabric-pattern

You take a collection of ideas or data or observations and you look for the most interesting and surprising patterns. Th

fabricpatternextractpatterns
extract_poc fabric-pattern

You are a super powerful AI cybersecurity expert system specialized in finding and extracting proof of concept URLs and

fabricpatternextractpoc
extract_predictions fabric-pattern

You fully digest input and extract the predictions made within.

fabricpatternextractpredictions
extract_primary_problem fabric-pattern

You are an expert at looking at a presentation, an essay, or a full body of lifetime work, and clearly and accurately ar

fabricpatternextractprimary
extract_primary_solution fabric-pattern

You are an expert at looking at a presentation, an essay, or a full body of lifetime work, and clearly and accurately ar

fabricpatternextractprimary
extract_product_features fabric-pattern

You extract the list of product features from the input.

fabricpatternextractproduct
extract_questions fabric-pattern

You are an advanced AI with a 419 IQ that excels at extracting all of the questions asked by an interviewer within a con

fabricpatternextractquestions
extract_recipe fabric-pattern

You are a passionate chef. You love to cook different food from different countries and continents - and are able to tea

fabricpatternextractrecipe
extract_recommendations fabric-pattern

You are an expert interpreter of the recommendations present within a piece of content.

fabricpatternextractrecommendations
extract_references fabric-pattern

You are an expert extractor of references to art, stories, books, literature, papers, and other sources of learning from

fabricpatternextractreferences
extract_skills fabric-pattern

You are an expert in extracting skill terms from the job description provided. You are also excellent at classifying ski

fabricpatternextractskills
extract_song_meaning fabric-pattern

You are an expert songwriter and musician that specializes in understanding the meaning of songs.

fabricpatternextractsong
extract_sponsors fabric-pattern

You are an expert at extracting the sponsors and potential sponsors from a given transcript, such a from a podcast, vide

fabricpatternextractsponsors
extract_videoid fabric-pattern

You are an expert at extracting video IDs from any URL so they can be passed on to other applications.

fabricpatternextractvideoid
ExtractWisdom skill

Dynamic wisdom extraction that adapts sections to content

extract wisdomanalyze videoanalyze podcastkey takeaways
Fabric skill

Intelligent prompt pattern system with 240+ patterns

fabricfabric patternextract wisdom
FactCheck skill

Claim verification and fact-checking with structured verdict tables

fact checkverify claimscheck statistics
Finance skill

Personal finance management via hledger on VPS

financehledgertransactionsbalances
find_female_life_partner fabric-pattern

You are a relationship and marriage and life happiness expert AI with a 4,227 IQ. You take criteria given to you about w

fabricpatternfindfemale
find_hidden_message fabric-pattern

You are an expert in political propaganda, analysis of hidden messages in conversations and essays, population control t

fabricpatternfindhidden
find_logical_fallacies fabric-pattern

You are an expert on all the different types of fallacies that are often used in argument and identifying them in input.

fabricpatternfindlogical
FirstPrinciples skill

First principles analysis and reasoning

first principlesfundamentalroot cause
fix_typos fabric-pattern

You are an AI assistant designed to function as a proofreader and editor. Your primary purpose is to receive a piece of

fabricpatternfixtypos
Form CRO skill

When the user wants to optimize any form that is NOT signup/registration — including lead capture forms, contact forms, demo request forms, application forms, or checkout forms.

marketingcroformsconversionlead-capture
FormatReminder hook

FormatReminder event hook

hookevent
Free Tool Strategy skill

When the user wants to plan, evaluate, or build a free tool for marketing purposes — lead generation, SEO value, or brand awareness. Bridges engineering and marketing.

marketingengineeringlead-generationseotools
GeminiResearch skill

Gemini CLI fallback for blocked sites (Reddit, X/Twitter)

geminifetch redditreddit thread
GeminiResearcher agent

GeminiResearcher agent definition

agentgeminiresearcher
generate_code_rules fabric-pattern

You are a senior developer and expert prompt engineer. Think ultra hard to distill the following transcription or tutori

fabricpatterngeneratecode
get_wow_per_minute fabric-pattern

You are an expert at determining the wow-factor of content as measured per minute of content, as determined by the steps

fabricpatterngetwow
get_youtube_rss fabric-pattern

You are a YouTube infrastructure expert that returns YouTube channel RSS URLs.

fabricpatterngetyoutube
gmail mcp-server

MCP server: gmail

mcpgmail
Goodbye skill

Session exit protocol - saves state, updates Soul/Brain/Heart

goodbyeend sessionsession end
greybeard_secure_prompt_engineer fabric-pattern

You are **Greybeard**, a principal-level systems engineer and security reviewer with NASA-style mission assurance discip

fabricpatterngreybeardsecure
GrokResearcher agent

GrokResearcher agent definition

agentgrokresearcher
heal_person fabric-pattern

You are an AI assistant whose primary responsibility is to interpret and analyze psychological profiles and/or psycholog

fabricpatternhealperson
humanize fabric-pattern

You are a real person whose job is to make text sound natural, conversational, and relatable, just like how an average p

fabricpatternhumanize
identify_dsrp_distinctions fabric-pattern

As a creative and divergent thinker, your ability to explore connections, challenge assumptions, and discover new possib

fabricpatternidentifydsrp
identify_dsrp_perspectives fabric-pattern

As a creative and divergent thinker, your ability to explore connections, challenge assumptions, and discover new possib

fabricpatternidentifydsrp
identify_dsrp_relationships fabric-pattern

As a creative and divergent thinker, your ability to explore connections, challenge assumptions, and discover new possib

fabricpatternidentifydsrp
identify_dsrp_systems fabric-pattern

As a creative and divergent thinker, your ability to explore connections, challenge assumptions, and discover new possib

fabricpatternidentifydsrp
identify_job_stories fabric-pattern

You are a versatile and perceptive Job Story Generator. Your purpose is to create insightful and relevant job stories th

fabricpatternidentifyjob
ImplicitSentimentCapture hook

ImplicitSentimentCapture event hook

hookevent
improve_academic_writing fabric-pattern

You are an academic writing expert. You refine the input text in academic and scientific language using common words for

fabricpatternimproveacademic
improve_prompt fabric-pattern

You are an expert LLM prompt writing service. You take an LLM/AI prompt as input and output a better prompt based on you

fabricpatternimproveprompt
improve_report_finding fabric-pattern

You are a extremely experienced 'jack-of-all-trades' cyber security consultant that is diligent, concise but informative

fabricpatternimprovereport
improve_writing fabric-pattern

You are a writing expert. You refine the input text to enhance clarity, coherence, grammar, and style.

fabricpatternimprovewriting
InboxCleaner skill

Autonomous email triage — classifies unread emails as important or not, marks unimportant as read

emailinboxtriagegmailcleanup
IntegrityCheck hook

IntegrityCheck event hook

hookevent
Intern agent

Intern agent definition

agentintern
IterativeDepth skill

Multi-angle iterative exploration for deeper ISC extraction

iterative depthdeep explorationmulti-angle analysis
judge_output fabric-pattern

You are a Honeycomb query evaluator with advanced capabilities to judge if a query is good or not.

fabricpatternjudgeoutput
label_and_rate fabric-pattern

IDENTITY and GOAL:

fabricpatternlabeland
Launch Strategy skill

When the user wants to plan a product launch, feature announcement, or release strategy. Covers phased launches, channel strategy, Product Hunt, and ongoing launch momentum.

marketinglaunchproduct-huntgo-to-marketannouncements
LoadContext hook

LoadContext event hook

hookevent
Marketing Ideas skill

When the user needs marketing ideas, inspiration, or strategies for their SaaS or software product. Provides 139 proven marketing approaches organized by category.

marketingstrategygrowthsaastacticsideas
Marketing Psychology skill

When the user wants to apply psychological principles, mental models, or behavioral science to marketing. Provides 70+ mental models organized for marketing application.

marketingpsychologypersuasionbehavioral-sciencemental-models
md_callout fabric-pattern

IDENTITY and GOAL:

fabricpatterncallout
model_as_sherlock_freud fabric-pattern

You are **The Sherlock-Freud Mind Modeler** — a fusion of meticulous detective reasoning and deep psychoanalytic insight

fabricpatternmodelsherlock
NotebookLM skill

Google NotebookLM integration via notebooklm-py CLI

NotebookLMnotebookpodcastaudio overview
obsidian mcp-server

MCP server: obsidian

mcpobsidian
official_pattern_template fabric-pattern

You are _____________ that specializes in ________________.

fabricpatternofficial
Onboarding CRO skill

When the user wants to optimize post-signup onboarding, user activation, first-run experience, or time-to-value.

marketingcroonboardingactivationuxsaas
OSINT skill

Open source intelligence gathering

osintdue diligenceinvestigate
Page CRO skill

When the user wants to optimize, improve, or increase conversions on any marketing page — including homepage, landing pages, pricing pages, feature pages, or blog posts.

marketingcroconversionlanding-pagesoptimization
PAI skill

Core SNAP/PAI system skill - The Algorithm and system architecture

algorithmpai systemcore system
Paid Ads skill

When the user wants help with paid advertising campaigns on Google Ads, Meta, LinkedIn, Twitter/X, or other ad platforms. Covers campaign strategy, audience targeting, and optimization.

marketingadsppcpaid-mediagoogle-adsmeta-adslinkedin-ads
PAIUpgrade skill

SNAP system upgrade and improvement extraction

upgradeimprove systemsystem upgrade
ParallelDispatch skill

Structured parallel agent dispatch for independent problems

paralleldispatchfan-outconcurrent
Parser skill

Parse URLs, files, and videos to structured JSON

parseextractURLtranscriptYouTube
Paywall & Upgrade CRO skill

When the user wants to create or optimize in-app paywalls, upgrade screens, upsell modals, or feature gates. Focuses on in-product upgrade moments where the user has already experienced value.

marketingcropaywallupsellfreemiumsaasmonetization
Pentester agent

Pentester agent definition

agentpentester
Popup CRO skill

When the user wants to create or optimize popups, modals, overlays, slide-ins, or banners for conversion purposes.

marketingcropopupsmodalslead-captureexit-intent
predict_person_actions fabric-pattern

You are an expert psychological analyst AI. Your task is to assess and predict how an individual is likely to respond to

fabricpatternpredictperson
prepare_7s_strategy fabric-pattern

You are a skilled business researcher preparing briefing notes that will inform strategic analysis.

fabricpatternpreparestrategy
Pricing Strategy skill

When the user wants help with pricing decisions, packaging, or monetization strategy. Covers pricing research, tier structure, and packaging strategy.

marketingpricingmonetizationsaaspackagingfreemium
PrivateInvestigator skill

Ethical people-finding and reconnection

find personlocatereconnect
Product Marketing Context skill

When the user wants to create or update their product marketing context document. Creates .agents/product-marketing-context.md that other marketing skills reference.

marketingpositioningcontextproduct-marketingfoundation
Programmatic SEO skill

When the user wants to create SEO-driven pages at scale using templates and data. Covers directory pages, location pages, comparison pages, and integration pages.

marketingseoprogrammatictemplatesscaleautomation
Prompting skill

Meta-prompting system for dynamic prompt generation

promptingmeta-promptprompt template
PromptInjection skill

Prompt injection testing and LLM security

prompt injectionjailbreakllm security
provide_guidance fabric-pattern

You are an all-knowing psychiatrist, psychologist, and life coach and you provide honest and concise advice to people ba

fabricpatternprovideguidance
QATester agent

QATester agent definition

agentqatester
QuestionAnswered hook

QuestionAnswered event hook

hookevent
rate_ai_response fabric-pattern

You are an expert at rating the quality of AI responses and determining how good they are compared to ultra-qualified hu

fabricpatternrateresponse
rate_ai_result fabric-pattern

You are an expert AI researcher and polymath scientist with a 2,129 IQ. You specialize in assessing the quality of AI /

fabricpatternrateresult
rate_content fabric-pattern

You are an ultra-wise and brilliant classifier and judge of content. You label content with a comma-separated list of si

fabricpatternratecontent
rate_value fabric-pattern

You are an expert parser and rater of value in content. Your goal is to determine how much value a reader/listener is be

fabricpatternratevalue
RatingCapture hook

RatingCapture event hook

hookevent
raw_query fabric-pattern

You are a universal AI that yields the best possible result given the input.

fabricpatternrawquery
recommend_artists fabric-pattern

You are an EDM expert who specializes in identifying artists that I will like based on the input of a list of artists at

fabricpatternrecommendartists
recommend_pipeline_upgrades fabric-pattern

You are an ASI master security specialist specializing in optimizing how one checks for vulnerabilities in one's own sys

fabricpatternrecommendpipeline
recommend_talkpanel_topics fabric-pattern

You read a full input of a person and their goals and their interests and ideas, and you produce a clean set of proposed

fabricpatternrecommendtalkpanel
recommend_yoga_practice fabric-pattern

You are an experienced **yoga instructor and mindful living coach**. Your role is to guide users in a calm, clear, and c

fabricpatternrecommendyoga
Recon skill

Security reconnaissance and attack surface analysis

reconreconnaissancebug bounty
RedTeam skill

Adversarial analysis with 32 agents

red teamattack ideastress test
Referral Program skill

When the user wants to create, optimize, or analyze a referral program, affiliate program, or word-of-mouth strategy. Covers program design, incentive structure, and growth optimization.

marketingreferralaffiliateviralword-of-mouthgrowth
refine_design_document fabric-pattern

You are an expert in software, cloud and cybersecurity architecture. You specialize in creating clear, well written desi

fabricpatternrefinedesign
RelationshipMemory hook

RelationshipMemory event hook

hookevent
Remotion skill

Programmatic video creation with React and Remotion

videoanimationmotion graphicsReact video
Research skill

Web research using multiple AI research agents

researchweb searchfind information
review_code fabric-pattern

You are a Principal Software Engineer, renowned for your meticulous attention to detail and your ability to provide clea

fabricpatternreviewcode
review_design fabric-pattern

You are an expert solution architect.

fabricpatternreviewdesign
RevOps skill

When the user wants help with revenue operations, lead lifecycle management, or marketing-to-sales handoff processes. Covers lead scoring, lead routing, CRM automation, and data hygiene.

marketingrevopssalescrmlead-scoringpipeline
Sales skill

Sales workflows - proposals, pricing, and outreach

salesproposalpricing
Sales Enablement skill

When the user wants to create sales collateral, pitch decks, one-pagers, objection handling docs, or demo scripts.

marketingsalesenablementpitch-deckcollateraldemo
sanitize_broken_html_to_markdown fabric-pattern

// Who you are

fabricpatternsanitizebroken
Schema Markup skill

When the user wants to add, fix, or optimize schema markup and structured data on their site. Covers JSON-LD, rich snippets, FAQ schema, product schema, and more.

marketingseoschemastructured-datajson-ldrich-snippets
Science skill

Universal thinking and iteration engine based on the scientific method

think aboutexperimentiteratehypothesis
SECUpdates skill

Security news aggregation from multiple sources

security newssecurity updatessec updates
SecurityValidator hook

SecurityValidator event hook

hookevent
SEO Audit skill

When the user wants to audit, review, or diagnose SEO issues on their site. Covers technical SEO, on-page SEO, meta tags, and SEO health checks.

marketingseoaudittechnical-seoon-pagemeta-tags
SessionAutoName hook

SessionAutoName event hook

hookevent
SessionSummary hook

SessionSummary event hook

hookevent
SetQuestionTab hook

SetQuestionTab event hook

hookevent
show_fabric_options_markmap fabric-pattern

You are an advanced UI builder that shows a visual representation of functionality that's provided to you via the input.

fabricpatternshow
Signup Flow CRO skill

When the user wants to optimize signup, registration, account creation, or trial activation flows.

marketingcrosignupregistrationonboardingconversion
Site Architecture skill

When the user wants to plan, map, or restructure their website's page hierarchy, navigation, URL structure, or internal linking.

marketingarchitecturenavigationurl-structureinformation-architecturesitemap
SkillGuard hook

SkillGuard event hook

hookevent
SNAP skill

SNAP core system skill - Personal AI Infrastructure architecture

SNAPcore systemPAI infrastructure
Social Content skill

When the user wants help creating, scheduling, or optimizing social media content for LinkedIn, Twitter/X, Instagram, TikTok, Facebook, or other platforms.

marketingsocial-mediacontentlinkedintwitterengagement
solve_with_cot fabric-pattern

You are an AI assistant designed to provide detailed, step-by-step responses. Your outputs should follow this structure:

fabricpatternsolvewith
SoulEvolution hook

SoulEvolution event hook

hookevent
StartupGreeting hook

StartupGreeting event hook

hookevent
StopOrchestrator hook

StopOrchestrator event hook

hookevent
suggest_gt_command fabric-pattern

You are an expert Gas Town (GT) assistant who knows every GT command intimately. Your role is to understand what the use

fabricpatternsuggestcommand
suggest_openclaw_pattern fabric-pattern

You are an expert Openclaw assistant who knows every Openclaw command intimately. Openclaw is an open-source AI agent fr

fabricpatternsuggestopenclaw
suggest_pattern fabric-pattern

You are an expert AI assistant specialized in the Fabric framework - an open-source tool for augmenting human capabiliti

fabricpatternsuggest
summarize fabric-pattern

You are an expert content summarizer. You take content in and output a Markdown formatted summary using the format below

fabricpatternsummarize
summarize_board_meeting fabric-pattern

You are a professional meeting secretary specializing in corporate governance documentation. Your purpose is to convert

fabricpatternsummarizeboard
summarize_debate fabric-pattern

// Who you are

fabricpatternsummarizedebate
summarize_git_changes fabric-pattern

You are an expert project manager and developer, and you specialize in creating super clean updates for what changed a G

fabricpatternsummarizegit
summarize_git_diff fabric-pattern

You are an expert project manager and developer, and you specialize in creating super clean updates for what changed in

fabricpatternsummarizegit
summarize_lecture fabric-pattern

As an organized, high-skill expert lecturer, your role is to extract the most relevant topics from a lecture transcript

fabricpatternsummarizelecture
summarize_legislation fabric-pattern

You are an expert AI specialized in reading and summarizing complex political proposals and legislation.

fabricpatternsummarizelegislation
summarize_meeting fabric-pattern

You are an AI assistant specialized in analyzing meeting transcripts and extracting key information. Your goal is to pro

fabricpatternsummarizemeeting
summarize_micro fabric-pattern

You are an expert content summarizer. You take content in and output a Markdown formatted summary using the format below

fabricpatternsummarizemicro
summarize_newsletter fabric-pattern

You are an advanced AI newsletter content extraction service that extracts the most meaningful and interesting and usefu

fabricpatternsummarizenewsletter
summarize_paper fabric-pattern

You are an excellent academic paper reviewer. You conduct paper summarization on the full paper text provided by the use

fabricpatternsummarizepaper
summarize_prompt fabric-pattern

You are an expert prompt summarizer. You take AI chat prompts in and output a concise summary of the purpose of the prom

fabricpatternsummarizeprompt
summarize_pull-requests fabric-pattern

You are an expert at summarizing pull requests to a given coding project.

fabricpatternsummarizepull-requests
summarize_rpg_session fabric-pattern

You are an expert summarizer of in-personal personal role-playing game sessions. You take the transcript of a conversati

fabricpatternsummarizerpg
SystematicDebugging skill

4-phase systematic debugging process for root cause analysis

debuggingbug fixroot causetest failure
t_analyze_challenge_handling fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternanalyzechallenge
t_check_dunning_kruger fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatterncheckdunning
t_check_metrics fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatterncheckmetrics
t_create_h3_career fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatterncreatecareer
t_create_opening_sentences fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatterncreateopening
t_describe_life_outlook fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatterndescribelife
t_extract_intro_sentences fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternextractintro
t_extract_panel_topics fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternextractpanel
t_find_blindspots fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternfindblindspots
t_find_negative_thinking fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternfindnegative
t_find_neglected_goals fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternfindneglected
t_give_encouragement fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatterngiveencouragement
t_red_team_thinking fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternredteam
t_threat_model_plans fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternthreatmodel
t_visualize_mission_goals_projects fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternvisualizemission
t_year_in_review fabric-pattern

You are an expert at understanding deep context about a person or entity, and then creating wisdom from that context com

fabricpatternyearreview
Telos skill

Life OS and project analysis system

teloslife goalsprojects
threshold fabric-pattern

IDENTITY and GOAL:

fabricpatternthreshold
to_flashcards fabric-pattern

You are a professional Anki card creator, able to create Anki cards from texts.

fabricpatternflashcards
transcribe_minutes fabric-pattern

You extract minutes from a transcribed meeting. You must identify all actionables mentioned in the meeting. You should f

fabricpatterntranscribeminutes
translate fabric-pattern

You are an expert translator who takes sentences or documentation as input and do your best to translate them as accurat

fabricpatterntranslate
TrendingResearch skill

Trending topic discovery and momentum analysis across tech, security, business, and culture

trendingwhat's trendingwhat's hot
tweet fabric-pattern

Title: A Comprehensive Guide to Crafting Engaging Tweets with Emojis

fabricpatterntweet
ultimate_law_safety fabric-pattern

You are an AGI safety evaluator implementing the Ultimate Law framework — a minimal, falsifiable ethical constraint syst

fabricpatternultimatelaw
Update skill

Self-update protocol - refresh identity, context, and memory

updateself-updaterefresh context
UpdateCounts hook

UpdateCounts event hook

hookevent
UpdateTabTitle hook

UpdateTabTitle event hook

hookevent
USMetrics skill

US economic indicators - GDP, inflation, unemployment, gas prices

GDPinflationunemploymenteconomic metrics
VoiceGate hook

VoiceGate event hook

hookevent
VoiceServer skill

Voice server management and TTS notifications

voiceservertts
WebAssessment skill

Web security assessment and penetration testing

web assessmentpentestsecurity testing
WorkCompletionLearning hook

WorkCompletionLearning event hook

hookevent
WorldThreatModelHarness skill

Persistent world model system across 11 time horizons for adversarial analysis

threat modelworld modelfuture analysisstress test
write_essay fabric-pattern

You are an expert on writing clear and illuminating essays on the topic of the input provided.

fabricpatternwriteessay
write_essay_pg fabric-pattern

You are an expert on writing concise, clear, and illuminating essays on the topic of the input provided.

fabricpatternwriteessay
write_hackerone_report fabric-pattern

You are an exceptionally talented bug bounty hunter that specializes in writing bug bounty reports that are concise, to-

fabricpatternwritehackerone
write_latex fabric-pattern

You are an expert at outputting syntactically correct LaTeX for a new .tex document. Your goal is to produce a well-form

fabricpatternwritelatex
write_micro_essay fabric-pattern

You are an expert on writing concise, clear, and illuminating essays on the topic of the input provided.

fabricpatternwritemicro
write_nuclei_template_rule fabric-pattern

You are an expert at writing YAML Nuclei templates, used by Nuclei, a tool by ProjectDiscovery.

fabricpatternwritenuclei
write_pull-request fabric-pattern

You are an experienced software engineer about to open a PR. You are thorough and explain your changes well, you provide

fabricpatternwritepull-request
write_semgrep_rule fabric-pattern

You are an expert at writing Semgrep rules.

fabricpatternwritesemgrep
WriteStory skill

Layered fiction writing system using Will Storr's storytelling science

write storyfictionnovelcreative writing
youtube_summary fabric-pattern

You are an AI assistant specialized in creating concise, informative summaries of YouTube video content based on transcr

fabricpatternyoutubesummary